PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 339aa    MW: 38272.1 Da    PI: 7.4984
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58688780PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-28543PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-324397155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprl+Wt +LHe+F++av++LGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Lsa009420 43 KPRLKWTLDLHEHFIDAVNRLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 97
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.38640100IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-294198IPR009057Homeodomain-like
SuperFamilySSF466892.87E-154298IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-224398IPR006447Myb domain, plants
PfamPF002491.6E-84596IPR001005SANT/Myb domain
PfamPF143791.0E-23145191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MYYHHNHQGK SVHSSSRISI TPERHLFLQG GGDSGLVLST DAKPRLKWTL DLHEHFIDAV  60
NRLGGADKAT PKSVLKLMGI QGLTLYHLKS HLQKYRLSKN LYRQTNSGDT NKVGMIAPAG  120
DANGETNGTQ MSNSSVCPQT NNNLQMSEAI QMQIEVQRRL HEQLEVQRHL QLRIEAQGKY  180
LQAVLEKAQE TLGKQNLGKV GVEAVKVQLS ELESKVSTHC LNSTFLGIKN VSMQTNQPTD  240
CSDDSFLTYC EGQQSEQEMI GLTFLESKKV DSDLSMTVGG HKRSEWNTSR SYNEKRFMYG  300
DEEVMLENIE RQKEFRFPYI GQKLDLNVHD VDHVASSHK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030697.11e-136Homeodomain-like superfamily protein isoform 2
RefseqXP_007030698.11e-136Homeodomain-like superfamily protein isoform 2
TrEMBLA0A061F9P81e-136A0A061F9P8_THECC; Homeodomain-like superfamily protein isoform 2
STRINGPOPTR_0013s05670.11e-126(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-113G2-like family protein